Sphingopyxis sp. QXT-31: BWQ93_09350
Help
Entry
BWQ93_09350 CDS
T04913
Name
(GenBank) GntR family transcriptional regulator
Organism
sphq
Sphingopyxis sp. QXT-31
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
FCD
GntR
PaaX
Rrf2
Motif
Other DBs
NCBI-ProteinID:
AQA00772
LinkDB
All DBs
Position
1942997..1943725
Genome browser
AA seq
242 aa
AA seq
DB search
MRVTKAASLADDLVQRFEQQIESGEMAPGARFPTEKAITEAFGVSRTVVREAYSRLAARG
LLVSRRGSGAYVADGARYRAFQIAADEFGAIEDVLRLLEMRMGFEAEMADLAARRRTEAD
LDAIRAALEAMENSANVDESVVADAAFHAAIAAATRNDYFLRFTQFLGVRLVPSRKLYLQ
GSDRQRHQQYARTINRDHQAIFDAIEAGDPAAARRAARRHMEKSIDRYRAMQDGLTTDST
DD
NT seq
729 nt
NT seq
+upstream
nt +downstream
nt
atgagggtgacgaaggcggcgtcgctggccgatgatctggtccagcgtttcgaacaacag
atcgaatcgggcgagatggcccccggcgcgcgcttcccgaccgagaaggcgatcaccgag
gcgttcggcgtcagccgcacggtggtgcgcgaggcctattcgcggctcgcggcgcgcggg
ctgctggtgtcgcgccgcgggtcgggcgcctatgtcgccgacggcgcgcgctatcgcgcc
ttccagatcgccgccgacgaattcggcgcgatcgaggatgtgctccgcctgctcgaaatg
cgcatgggcttcgaggcggaaatggccgacctcgcggcgcgccgccggaccgaagcggat
ctggacgcgatccgcgccgcgctcgaggcgatggaaaacagcgccaacgtcgacgaatcg
gtcgtcgccgacgcggcgtttcatgcggcgatcgccgccgcgacgcgcaacgattatttc
ctgcgcttcacccagttcctcggcgtgcgcctcgtcccctcgcgcaagctctatctgcag
ggcagcgaccgccagcggcaccagcaatatgcgcgcacgatcaaccgcgaccatcaggcg
atcttcgatgcgatcgaggcgggcgacccggcagcggcgcggcgcgcggcgcggcgccat
atggaaaaatcgatcgaccgctatcgcgcaatgcaggacggcctgacgacggattcgacc
gacgactga
DBGET
integrated database retrieval system