Sphingopyxis sp. QXT-31: BWQ93_10045 Help Entry BWQ93_10045       CDS       T04913                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sphq  Sphingopyxis sp. QXT-31 Pathway sphq01100   Metabolic pathways sphq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sphq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BWQ93_10045    00074 Mycolic acid biosynthesis     BWQ93_10045   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BWQ93_10045 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  APZ98795 UniProt:  A0A1P8WXL0 LinkDB All DBs Position complement(2092234..2092470) Genome browser AA seq 78 aa AA seqDB search MSDSAEKVKKIVVEHLGVEADKVTEEASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKIATVKDAIDYIEANKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgattcggccgaaaaggttaagaagatcgtcgtcgaacatctgggcgtcgaagcc gacaaggtcaccgaagaagcgagcttcatcgacgatctgggcgccgacagcctcgacatc gtcgaactggtgatggcgttcgaagaagaattcggcgtcgaaatccccgacgacgcggcg gaaaagatcgccaccgtcaaggatgcgatcgactatatcgaagcgaacaagggctaa

DBGET integrated database retrieval system