Sphingobium sp. RAC03: BSY17_2752 Help Entry BSY17_2752        CDS       T04461                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sphr  Sphingobium sp. RAC03 Pathway sphr01100   Metabolic pathways sphr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sphr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BSY17_2752 (acpP)    00074 Mycolic acid biosynthesis     BSY17_2752 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BSY17_2752 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF1493 Ribosomal_L50 DUF5783 Motif Other DBs NCBI-ProteinID:  AOF96550 UniProt:  A0A1B3MTX5 LinkDB All DBs Position 2799976..2800209 Genome browser AA seq 77 aa AA seqDB search MSETADRVKKIVVEHLGVEAEKVTEDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKIATVKDAIDYIDSKQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtgagaccgcggatcgcgtaaagaaaatcgtcgtcgagcatctgggcgttgaagcc gaaaaggtgaccgaggatgccagcttcatcgacgatctgggcgctgacagcctcgacatc gttgagctggtcatggcgttcgaagaagaattcggcgtcgaaatccccgacgatgcggcc gagaagatcgccaccgtcaaggatgccatcgattatatcgacagcaagcagtaa

DBGET integrated database retrieval system