Sphingosinicella sp. BN140058: ETR14_02240 Help Entry ETR14_02240       CDS       T05826                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism sphs  Sphingosinicella sp. BN140058 Pathway sphs00190   Oxidative phosphorylation sphs01100   Metabolic pathways Module sphs_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:sphs00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     ETR14_02240  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:sphs00194]     ETR14_02240 Photosynthesis proteins [BR:sphs00194]  Photosystem and electron transport system   F-type ATPase [OT]    ETR14_02240 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C SP_C-Propep DUF5671 Motif Other DBs NCBI-ProteinID:  QAY75476 UniProt:  A0A4P6FHI3 LinkDB All DBs Position complement(505106..505333) Genome browser AA seq 75 aa AA seqDB search MDAEAAKLLGAGLAAIGVGMAALGVGNVFGSFLESALRNPAAADSQQGRLFIGFAAAELL GLLAFVVAMILLFVA NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggacgcagaagccgcaaagctgctcggtgccggtctcgctgcaatcggcgtcggcatg gccgccctcggcgtgggcaacgtgttcggctcgttcctcgagagcgcgctgcgcaatccg gccgcggccgacagccagcagggccgtctcttcatcggcttcgccgccgccgagcttctc ggcctgctggcgttcgtcgttgcgatgatcctgctcttcgtcgcgtaa

DBGET integrated database retrieval system