Sphingosinicella sp. BN140058: ETR14_02515 Help Entry ETR14_02515       CDS       T05826                                  Name (GenBank) ATP synthase F1 subunit epsilon   KO K02114   F-type H+-transporting ATPase subunit epsilon Organism sphs  Sphingosinicella sp. BN140058 Pathway sphs00190   Oxidative phosphorylation sphs01100   Metabolic pathways Module sphs_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:sphs00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     ETR14_02515  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:sphs00194]     ETR14_02515 Photosynthesis proteins [BR:sphs00194]  Photosystem and electron transport system   F-type ATPase [OT]    ETR14_02515 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_DE_N Motif Other DBs NCBI-ProteinID:  QAY75519 LinkDB All DBs Position 563600..563866 Genome browser AA seq 88 aa AA seqDB search MADLHFELVTPERLVRSDDVYMVVVPGSEGEFGVLAGHAPFMSTLRNGDIAIYRTAGAEP ERIPVEGGFAEVSDRGLTVLAERADVPA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggccgatctccatttcgaactcgtcacgccagagcgtctcgtccgcagcgacgacgtc tacatggtcgtggttcccggcagcgagggtgaattcggcgtgctcgccggccatgcgccc ttcatgtccactctgcgcaacggcgacatcgccatctaccgcaccgccggtgcggagccg gaacggatcccggtcgaaggcggcttcgccgaagtcagcgatcgcggcctgaccgtgctc gccgagcgggccgacgttcccgcctga

DBGET integrated database retrieval system