Sphingobium sp. TKS: K426_03545 Help Entry K426_03545        CDS       T04965                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism spht  Sphingobium sp. TKS Pathway spht00362   Benzoate degradation spht00621   Dioxin degradation spht00622   Xylene degradation spht01100   Metabolic pathways spht01120   Microbial metabolism in diverse environments spht01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:spht00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     K426_03545    00622 Xylene degradation     K426_03545    00621 Dioxin degradation     K426_03545 Enzymes [BR:spht01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      K426_03545 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Motif Other DBs NCBI-ProteinID:  AMK21665 UniProt:  A0A126RJC3 LinkDB All DBs Position 1:complement(675373..675564) Genome browser AA seq 63 aa AA seqDB search MSVARSEQELIRHVTDAALSVEGEGRPSVTWVTIEDVAPGPWGVGGKPDSEDDLRAMAQK SAA NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atgtctgtcgctcgatcagaacaggaattgatccgccatgtcaccgacgcggcgctgtcg gtcgagggcgaaggacgcccctcggtcacctgggtcacgatcgaggatgtcgcgcccggc ccatggggcgtcggtggcaagcccgattccgaagatgacctgcgcgcaatggcgcagaaa tccgccgcctga

DBGET integrated database retrieval system