Sphingobium sp. TKS: K426_08860 Help Entry K426_08860        CDS       T04965                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spht  Sphingobium sp. TKS Pathway spht01100   Metabolic pathways spht01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spht00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K426_08860 (acpP)    00074 Mycolic acid biosynthesis     K426_08860 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K426_08860 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF1493 Ribosomal_L50 DUF5783 Motif Other DBs NCBI-ProteinID:  AMK22717 UniProt:  A0A126RKN1 LinkDB All DBs Position 1:1745631..1745864 Genome browser AA seq 77 aa AA seqDB search MSETADRVKKIVVEHLGVEAEKVTEDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKIATVKDAIDYIDSKQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtgagaccgcggatcgcgtaaagaaaatcgtcgtcgagcatctgggcgtcgaagcc gaaaaggtgaccgaggatgcgagcttcattgacgatctgggcgctgacagcctggacatc gttgagctggtgatggcgttcgaggaagaattcggcgtcgaaatccctgacgatgcggcg gagaagatcgccaccgtcaaggacgccatcgattatatcgacagcaagcagtaa

DBGET integrated database retrieval system