Uncultured Sphingopyxis sp. UC10: SPPYR_1259 Help Entry SPPYR_1259        CDS       T05531                                  Symbol hup Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism sphu  Uncultured Sphingopyxis sp. UC10 Brite KEGG Orthology (KO) [BR:sphu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sphu03032]     SPPYR_1259 (hup)    03036 Chromosome and associated proteins [BR:sphu03036]     SPPYR_1259 (hup)    03400 DNA repair and recombination proteins [BR:sphu03400]     SPPYR_1259 (hup) DNA replication proteins [BR:sphu03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     SPPYR_1259 (hup) Chromosome and associated proteins [BR:sphu03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     SPPYR_1259 (hup) DNA repair and recombination proteins [BR:sphu03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       SPPYR_1259 (hup) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Phage_cement_2 DUF2267 Peptidase_C23 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  SBV32379 UniProt:  A0A1Y5PQW3 LinkDB All DBs Position SPPYR:complement(1356638..1356913) Genome browser AA seq 91 aa AA seqDB search MNHAELSDSVAAALGTSKADGKKTVEAVFAAIADAAAKGEEVSVNGFGKFKVKKSAAREG RNPSTGATIQIAASKKLGFSAAKAVKDKLNG NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaccacgccgaattgtccgacagcgtcgccgccgcgctcgggacgagcaaggccgac ggcaagaagaccgtcgaggccgtcttcgccgcgatcgcggacgccgctgccaagggtgaa gaagtgtcggtgaacggcttcggcaagttcaaggtcaagaaatcggccgcacgcgaaggc cgcaatccttcgaccggcgcgacgatccagatcgcggcttcgaagaagctcggcttctcg gcggccaaagcggtcaaggacaagctgaacggctga

DBGET integrated database retrieval system