Uncultured Sphingopyxis sp. UC10: SPPYR_2457 Help Entry SPPYR_2457        CDS       T05531                                  Symbol acpP Name (GenBank) acyl carrier protein (ACP)   KO K02078   acyl carrier protein Organism sphu  Uncultured Sphingopyxis sp. UC10 Pathway sphu01100   Metabolic pathways sphu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sphu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SPPYR_2457 (acpP)    00074 Mycolic acid biosynthesis     SPPYR_2457 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SPPYR_2457 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  SBV33577 UniProt:  A0A1Y5Q1D3 LinkDB All DBs Position SPPYR:complement(2599152..2599388) Genome browser AA seq 78 aa AA seqDB search MSDSAEKVKKIVVEHLGVEADKVTEEASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKIATVKDAIDYIEANKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgattcggccgaaaaggttaaaaagatcgtcgtcgaacatctgggcgtcgaagcc gacaaggtcaccgaggaagcgagcttcatcgacgatctgggcgccgacagcctcgacatc gtcgaactggtgatggcgttcgaggaagaattcggcgtcgaaatccccgacgatgcggcg gaaaagatcgccaccgtcaaggacgcgatcgactatatcgaagcgaacaagggctaa

DBGET integrated database retrieval system