Streptomyces phaeolivaceus: F9278_33870 Help Entry F9278_33870       CDS       T07107                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism sphv  Streptomyces phaeolivaceus Pathway sphv00190   Oxidative phosphorylation sphv01100   Metabolic pathways Module sphv_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:sphv00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     F9278_33870 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:sphv00194]     F9278_33870 (atpE) Photosynthesis proteins [BR:sphv00194]  Photosystem and electron transport system   F-type ATPase [OT]    F9278_33870 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  QFR00331 UniProt:  A0A5P8KBE5 LinkDB All DBs Position 7306690..7306923 Genome browser AA seq 77 aa AA seqDB search MAALETLAAVEGNIGSIGYGLAAIGPGVGVGIIFGNGTQALARQPEAAGLIRANQILGFA FCEALALIGIVMPFVYN NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggctgcccttgagaccctcgccgctgtcgaaggcaacatcggttccatcggctacggc ctcgccgccatcggccccggcgtcggcgtcggcatcatcttcggcaacggcacccaggcg ctcgcccgtcagcccgaggccgccggtctgatccgtgccaaccagatcctcggcttcgcc ttctgtgaggcgctcgccctcatcggcatcgtcatgccgttcgtctacaactga

DBGET integrated database retrieval system