Streptomyces phaeolivaceus: F9278_45295 Help Entry F9278_45295       CDS       T07107                                  Name (GenBank) hypothetical protein   KO K00052   3-isopropylmalate dehydrogenase [EC:1.1.1.85] Organism sphv  Streptomyces phaeolivaceus Pathway sphv00290   Valine, leucine and isoleucine biosynthesis sphv00660   C5-Branched dibasic acid metabolism sphv01100   Metabolic pathways sphv01110   Biosynthesis of secondary metabolites sphv01210   2-Oxocarboxylic acid metabolism sphv01230   Biosynthesis of amino acids Module sphv_M00432   Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate Brite KEGG Orthology (KO) [BR:sphv00001]  09100 Metabolism   09101 Carbohydrate metabolism    00660 C5-Branched dibasic acid metabolism     F9278_45295   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     F9278_45295 Enzymes [BR:sphv01000]  1. Oxidoreductases   1.1  Acting on the CH-OH group of donors    1.1.1  With NAD+ or NADP+ as acceptor     1.1.1.85  3-isopropylmalate dehydrogenase      F9278_45295 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Iso_dh Motif Other DBs NCBI-ProteinID:  QFR03217 UniProt:  A0A5P8KJG9 LinkDB All DBs Position complement(9966664..9966945) Genome browser AA seq 93 aa AA seqDB search MAQASHGSAPDITGRGIANPVAMILSGAMLFTWLGAKHGDEAAGRVARTVERAVAETIAS GVSTRDLGGSASTTEFTGAVVRAVGAGAAPGGA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggcccaggcgtcccacggctccgcccccgacatcaccgggcggggcatcgccaacccg gtggccatgatcctgtccggtgccatgctcttcacatggctcggggccaagcacggtgac gaggcggccggacgcgtcgcgcggaccgtcgagagggcggtggccgagacgatcgcctcc ggtgtctccacccgtgacctgggcggctccgcctccaccaccgagttcaccggcgccgtg gtccgggcggtcggcgccggtgccgcaccgggcggcgcctga

DBGET integrated database retrieval system