Streptomyces phaeoluteigriseus: NFX46_36810 Help Entry NFX46_36810       CDS       T08568                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sphw  Streptomyces phaeoluteigriseus Pathway sphw00998   Biosynthesis of various antibiotics sphw01100   Metabolic pathways sphw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sphw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NFX46_36810    00074 Mycolic acid biosynthesis     NFX46_36810   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NFX46_36810 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  USQ88825 UniProt:  A0ABY4ZIQ4 LinkDB All DBs Position complement(8349480..8349734) Genome browser AA seq 84 aa AA seqDB search MSAITIDEAVETQVRAIVADALELEEELTPTGMFVDEYGADSLAAIELLSTLEKTFGVTI EQDELPKMVNLEAVLEVLSRAAAR NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagtgccatcaccatcgacgaggccgtcgagacccaggtgagagcgatcgtcgccgac gccctcgaactggaggaggagctgaccccgaccggcatgttcgtcgacgagtacggcgcc gactccctcgccgcgatcgaactgctgtccacgctggagaagaccttcggcgtgacgatc gagcaggacgaactgcccaagatggtcaacctcgaggccgtcctcgaggtgctgtcccgg gccgcggcgcgatga

DBGET integrated database retrieval system