Sphingopyxis sp. PAMC25046: E5675_11615 Help Entry E5675_11615       CDS       T06315                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism sphx  Sphingopyxis sp. PAMC25046 Pathway sphx00190   Oxidative phosphorylation sphx01100   Metabolic pathways Module sphx_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:sphx00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     E5675_11615  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:sphx00194]     E5675_11615 Photosynthesis proteins [BR:sphx00194]  Photosystem and electron transport system   F-type ATPase [OT]    E5675_11615 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  QCB55024 UniProt:  A0A4P7RXQ2 LinkDB All DBs Position complement(2484008..2484238) Genome browser AA seq 76 aa AA seqDB search MDVQAASLIGAGLAAIGAGMAAIGVGNVFGSFLESALRNPAAADGQQGRLFIGFAAAELL GLLSFLIAILLYLKAA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggacgttcaagctgcttcgctcatcggcgccggtctggccgctatcggtgccggtatg gccgccatcggtgtgggcaacgtgttcggtagcttcctcgaaagcgcgctgcgcaacccc gcagcggccgacggccagcagggccgcctgttcatcggcttcgcggccgccgaacttctc ggcctgctgtcgttcctgatcgcgatcctgctgtacctcaaggcagcctga

DBGET integrated database retrieval system