Sphingopyxis sp. PAMC25046: E5675_12995 Help Entry E5675_12995       CDS       T06315                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism sphx  Sphingopyxis sp. PAMC25046 Brite KEGG Orthology (KO) [BR:sphx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sphx03032]     E5675_12995    03036 Chromosome and associated proteins [BR:sphx03036]     E5675_12995    03400 DNA repair and recombination proteins [BR:sphx03400]     E5675_12995 DNA replication proteins [BR:sphx03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     E5675_12995 Chromosome and associated proteins [BR:sphx03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     E5675_12995 DNA repair and recombination proteins [BR:sphx03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       E5675_12995 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 DUF2267 Peptidase_M35 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  QCB55255 UniProt:  A0A4P7RXS0 LinkDB All DBs Position complement(2759222..2759494) Genome browser AA seq 90 aa AA seqDB search MNKQDLIAAVADSSGLTKGDASKAVEAVFDAITGSLKKGGEVRLVGFGTFAVSKRKASTG RNPRTGETMTIAASNQPKFKAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaagacctgatcgccgccgtcgccgattcgagcggcctgaccaagggtgat gccagcaaggccgtggaagctgtcttcgacgcgatcaccggctcgctgaagaagggcggc gaagtccgtctcgtcggcttcggcaccttcgcggtcagcaagcgcaaggcatcgaccggt cgcaacccgcgcaccggcgaaacgatgaccatcgcggcgtcgaaccagccgaagttcaag gccggcaaggccctcaaggacgccgtcaactaa

DBGET integrated database retrieval system