Sphingopyxis sp. PAMC25046: E5675_15130
Help
Entry
E5675_15130 CDS
T06315
Name
(GenBank) ABC transporter ATP-binding protein
KO
K02052
putative spermidine/putrescine transport system ATP-binding protein
Organism
sphx
Sphingopyxis sp. PAMC25046
Pathway
sphx02024
Quorum sensing
Brite
KEGG Orthology (KO) [BR:
sphx00001
]
09140 Cellular Processes
09145 Cellular community - prokaryotes
02024 Quorum sensing
E5675_15130
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
sphx02000
]
E5675_15130
Transporters [BR:
sphx02000
]
ABC transporters, prokaryotic type
Mineral and organic ion transporters
Putative spermidine/putrescine transporter
E5675_15130
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
TOBE_2
AAA_21
nSTAND3
AAA_25
OB_MalK
AAA_22
AAA_16
AAA_29
Rad17
Motif
Other DBs
NCBI-ProteinID:
QCB55631
LinkDB
All DBs
Position
3209854..3210972
Genome browser
AA seq
372 aa
AA seq
DB search
MTAPPPLVEFRGVEKRYAAGGPAAVADLDLAIERGEFLTLLGPSGSGKTTTLMMLAGFET
PSAGEILLGGASLTDRPPYRRNMGVVFQNYALFPHMSVAENVAFPLRVRGIRGAETTTKV
ANALALVKLDGLGARRPDALSGGQRQRVALARALVFEPDLVLMDEPLGALDRQLREHLQI
EIKRIQRALGLTIVYVTHDQGEALTMSDRIAVFAAGRIQQVGRPDAIYETPANAFVAGFV
GENNMLAGTVVTRHDDRCAVRLPGGQIVRALATGAMTAGDAVVATIRPEHVETGSAPLAC
CNAIEARVEELAYHGDHSRIRAALDGGGSLLIRTPATPGIAPGQRIPVGWCTDRCFAFPA
EDRAALQQREVA
NT seq
1119 nt
NT seq
+upstream
nt +downstream
nt
atgaccgcgccgccccctctcgtcgaatttcgcggcgtcgagaaacgctatgccgcgggt
ggcccggctgccgtcgccgatctcgaccttgcgattgagcgcggcgagtttctgacgctg
ctcggcccatcggggtcggggaagacgacgacgctgatgatgctcgcagggttcgaaacc
cccagcgcaggtgagatactgctcggcggtgcgtcgctcacggaccgtccgccatatcgg
cgcaacatgggcgtcgttttccagaattatgcgctgttcccccatatgagcgtcgccgaa
aatgtcgccttcccgcttcgcgtgcgcgggataaggggcgccgagaccacaacgaaagtg
gcgaatgcgctcgcgttggtaaagcttgacgggctcggcgcgcggcgccccgatgcgctc
tccggcgggcagcgccagcgcgtcgcgctcgcgcgcgcgctagtgttcgaacccgacctc
gtgctgatggacgaaccgcttggcgcgctcgaccgccagttgcgcgagcatctgcagatc
gagatcaagcggatccaacgcgcgctagggctcaccatcgtctatgtcacgcacgatcag
ggcgaagcgttgacgatgtccgaccggatcgcagtgttcgcggcggggcgcatccagcag
gtcgggcggcccgacgcgatctacgaaacgccagccaatgccttcgtcgccggcttcgtc
ggcgagaacaatatgctggcgggcacggtggtgacacggcacgacgatcgatgcgccgtc
cggctgcccggcgggcagatcgtccgcgcgctggcgacgggcgctatgacggccggggac
gccgtggtcgcgaccatccgtcccgagcatgtcgagacgggttccgcccctcttgcctgc
tgcaacgccatcgaagcgcgggtcgaggagcttgcctatcacggcgatcacagccgcatt
cgcgcggcgctcgatggcggcggctcgctcctcatccggacgcccgccacacccgggatc
gcgcccggacagcggattccggtcggctggtgcaccgaccgctgtttcgcctttcccgcc
gaagatcgtgccgccttgcagcaaagagaagtcgcatga
DBGET
integrated database retrieval system