Sphingopyxis sp. PAMC25046: E5675_16940 Help Entry E5675_16940       CDS       T06315                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sphx  Sphingopyxis sp. PAMC25046 Pathway sphx01100   Metabolic pathways sphx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sphx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     E5675_16940    00074 Mycolic acid biosynthesis     E5675_16940   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     E5675_16940 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF2827 Motif Other DBs NCBI-ProteinID:  QCB55949 LinkDB All DBs Position 3606412..3606648 Genome browser AA seq 78 aa AA seqDB search MSTAIKDQIYGLIAPFNKKGVELTDATTFAGDLEWDSLTVMDFVAEVEDTFDIIISMNMQ AEIETVGQLVAAVEKLQG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccgccatcaaggaccagatttacggtctgatcgcacccttcaacaagaagggc gtcgaactgaccgacgcgacgacctttgccggcgatctcgaatgggacagtctgaccgtg atggacttcgtcgccgaggtcgaggatacgttcgacatcatcatcagcatgaacatgcag gccgagatcgaaaccgtcggccagctcgtcgccgcggtcgagaagctgcagggctga

DBGET integrated database retrieval system