Sphingopyxis sp. PAMC25046: E5675_20160 Help Entry E5675_20160       CDS       T06315                                  Name (GenBank) ATP synthase F1 subunit epsilon   KO K02114   F-type H+-transporting ATPase subunit epsilon Organism sphx  Sphingopyxis sp. PAMC25046 Pathway sphx00190   Oxidative phosphorylation sphx01100   Metabolic pathways Module sphx_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:sphx00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     E5675_20160  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:sphx00194]     E5675_20160 Photosynthesis proteins [BR:sphx00194]  Photosystem and electron transport system   F-type ATPase [OT]    E5675_20160 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_DE_N Motif Other DBs NCBI-ProteinID:  QCB56522 UniProt:  A0A4P7S321 LinkDB All DBs Position complement(4262089..4262346) Genome browser AA seq 85 aa AA seqDB search MALKFELVTPARLERTADVHMVTVPGTEGDFSVLEGHAPFMATLRNGPLTIYATAGAAPE VIEVEGGFAEVNEAGLTVLAEHIAG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggccctgaagttcgaactcgtcactcccgcccgcctcgagcggaccgccgacgtccat atggtcaccgtcccggggaccgagggcgatttctcggtgctcgaaggccacgcgcccttc atggcgacgctgcgcaacggcccgctgaccatctatgccaccgcgggcgccgcgcccgag gtgatcgaggtcgaaggcggcttcgccgaggtcaacgaagcgggcctcaccgtgctggct gaacatatcgccggatag

DBGET integrated database retrieval system