Sphingorhabdus sp. YGSMI21: CHN51_12575 Help Entry CHN51_12575       CDS       T05308                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism sphy  Sphingorhabdus sp. YGSMI21 Brite KEGG Orthology (KO) [BR:sphy00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:sphy03110]     CHN51_12575 (grxC) Chaperones and folding catalysts [BR:sphy03110]  Protein folding catalysts   Protein disulfide isomerase    CHN51_12575 (grxC) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Glutaredoxin SH3BGR GST_N_3 GST_N_2 Glrx-like GST_N Motif Other DBs NCBI-ProteinID:  ATW04275 LinkDB All DBs Position 2601331..2601588 Genome browser AA seq 85 aa AA seqDB search MAKVEIYTKFTCGFCFRAKALLEGKNVSFEETDISMGGEKREEMIQRSGGRMTVPQIFID DRHIGGSDDLAALDRSGELDALLAG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggctaaagttgaaatatataccaaatttacctgtggcttctgctttcgtgcgaaagcc ttgctggaaggcaagaatgtcagtttcgaggaaacggacatcagcatgggtggcgagaaa cgcgaggagatgatccagcggtccggcggcagaatgacggtgccgcagatattcatcgat gaccgtcatatcggcggatcggacgatctggctgccctggaccggtcgggcgagctcgac gcgcttctggcgggctga

DBGET integrated database retrieval system