Sphingorhabdus sp. YGSMI21: CHN51_15820 Help Entry CHN51_15820       CDS       T05308                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sphy  Sphingorhabdus sp. YGSMI21 Pathway sphy01100   Metabolic pathways sphy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sphy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CHN51_15820    00074 Mycolic acid biosynthesis     CHN51_15820   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CHN51_15820 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF5783 DUF1493 Motif Other DBs NCBI-ProteinID:  ATW04836 UniProt:  A0A2D3RGM3 LinkDB All DBs Position complement(3300025..3300261) Genome browser AA seq 78 aa AA seqDB search MSETADRVKKIVVEHLGVEADKVTEEAAFIDDLGADSLDIVELVMAFEEEFSVEIPDDAA EKIGTVKDAIDFIDKNKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgagactgcagaccgcgtaaaaaagattgttgttgagcatctgggtgttgaagcc gacaaagtcaccgaagaagctgccttcatcgatgatctgggcgctgacagcctcgacatt gttgagctggttatggcgtttgaagaagaattcagcgtcgaaattccagatgatgccgct gaaaaaatcggtaccgtcaaagacgccatcgattttatcgacaaaaacaaaggctaa

DBGET integrated database retrieval system