Sphingorhabdus sp. YGSMI21: CHN51_16190 Help Entry CHN51_16190       CDS       T05308                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sphy  Sphingorhabdus sp. YGSMI21 Pathway sphy01100   Metabolic pathways sphy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sphy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CHN51_16190    00074 Mycolic acid biosynthesis     CHN51_16190   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CHN51_16190 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ATW04899 UniProt:  A0A2D3RI21 LinkDB All DBs Position 3382878..3383150 Genome browser AA seq 90 aa AA seqDB search MQNKVELTPEAAVRAVMRDILGLSEEQVAEFTAETELFGALPELDSMAVAGLLTELEDRL DIMIDDDEVDGELFETFGNLVAFAEMKVTE NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgcagaataaggtcgagttgacgccggaagccgccgtgcgtgcagtgatgcgtgatatt ttgggactgagcgaagagcaggtcgcggaattcacggcggaaacagagctttttggcgcc ctccccgaactcgacagcatggccgttgccgggctgctcaccgaactggaagatcgtctg gacatcatgatcgacgatgatgaagtcgatggcgaactgttcgagactttcggcaatctg gtcgcctttgccgagatgaaagtcaccgagtga

DBGET integrated database retrieval system