Sphingorhabdus sp. YGSMI21: CHN51_18080 Help Entry CHN51_18080       CDS       T05308                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism sphy  Sphingorhabdus sp. YGSMI21 Brite KEGG Orthology (KO) [BR:sphy00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sphy03032]     CHN51_18080    03036 Chromosome and associated proteins [BR:sphy03036]     CHN51_18080    03400 DNA repair and recombination proteins [BR:sphy03400]     CHN51_18080 DNA replication proteins [BR:sphy03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CHN51_18080 Chromosome and associated proteins [BR:sphy03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     CHN51_18080 DNA repair and recombination proteins [BR:sphy03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       CHN51_18080 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 DUF2267 Nup214_FG Rpf1_C Motif Other DBs NCBI-ProteinID:  ATW05224 UniProt:  A0A2D3RHM2 LinkDB All DBs Position 3785133..3785450 Genome browser AA seq 105 aa AA seqDB search MNRQDLISAVAEASGLSKTDAAKAVDAIFDAIAGTLSRGGDVRLAGFGTFSTSRRKASTG RNPRTGEPMQLAPSTSAKFKAGKGLKEAINNRRGGDDGWIGPKFR NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgaaccgacaggacctcatcagcgccgttgccgaagcaagcggcctgagcaagacagac gcagccaaagcggtcgacgcgattttcgatgcgattgcgggtacattgagccggggcgga gatgtccgtctcgccggatttggcacattctccacatccagacgcaaggcatcgaccggc agaaacccccgcaccggggaaccgatgcaattagcaccctcgaccagtgcaaaattcaag gccgggaagggtctgaaagaagccatcaacaaccgccgcggcggcgatgatggctggatt ggccccaaattcagataa

DBGET integrated database retrieval system