Spirosoma aureum: G8759_17455 Help Entry G8759_17455       CDS       T06520                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spib  Spirosoma aureum Pathway spib01100   Metabolic pathways spib01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spib00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G8759_17455    00074 Mycolic acid biosynthesis     G8759_17455   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G8759_17455 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 BEN Motif Other DBs NCBI-ProteinID:  QIP14274 UniProt:  A0A6G9APL4 LinkDB All DBs Position complement(4423512..4423757) Genome browser AA seq 81 aa AA seqDB search MTLALINSRLQDILVNMGVNLTALTDQANFIRDLGLDSLDVTDLLIQVENSFSIRIPDED WWKLQTVGQLKNYLSHEVTFD NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgacacttgcactgataaacagtcgtttgcaggacatactcgttaatatgggtgtcaat ttaacggcgctcaccgatcaggctaacttcatccgggatctgggccttgattcacttgac gttaccgacctgcttattcaggttgaaaatagctttagtattcgcattccagatgaggat tggtggaaactgcaaacggttggtcaattaaaaaactaccttagtcatgaggtgacattt gactaa

DBGET integrated database retrieval system