Streptomyces phytohabitans: ABXR15_20425 Help Entry ABXR15_20425      CDS       T10861                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spih  Streptomyces phytohabitans Pathway spih00998   Biosynthesis of various antibiotics spih01100   Metabolic pathways spih01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spih00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ABXR15_20425    00074 Mycolic acid biosynthesis     ABXR15_20425   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ABXR15_20425 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 EVE Motif Other DBs NCBI-ProteinID:  XCX51288 LinkDB All DBs Position complement(4891114..4891362) Genome browser AA seq 82 aa AA seqDB search MAATQEEIIAGLAEIVNEIAGIPTEDVQEDKSFTDDLDVDSLSMVEVVVAAEERFNVKIP DDDVKNLKTVGDATKYILEHQG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccacgcaggaagagatcatcgccggtctcgcggagatcgtgaacgagatcgcc ggtatccccaccgaggacgtccaggaggacaagtccttcacggacgacctggacgtggac tcgctgtcgatggtcgaggtcgtcgtcgccgccgaggagcgcttcaacgtgaagatcccg gacgacgacgtcaagaacctcaagacggtcggcgacgccaccaagtacatcctggagcac cagggctga

DBGET integrated database retrieval system