Sphingomonas piscis: G7077_05565 Help Entry G7077_05565       CDS       T07460                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spii  Sphingomonas piscis Pathway spii01100   Metabolic pathways spii01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spii00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G7077_05565    00074 Mycolic acid biosynthesis     G7077_05565   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G7077_05565 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QIK78448 UniProt:  A0A6G7YNX7 LinkDB All DBs Position 1134294..1134539 Genome browser AA seq 81 aa AA seqDB search MTDRAETQAKILSLIEPFNKKGVEVTEATRFAQDLEWDSLTVLDFVATIEDEFDVLISMN MQAEIENVGQLVDAVEKLKAA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaccgaccgtgccgaaacacaagccaagatcctctccctgattgagcccttcaacaag aagggcgtcgaggtgacggaggcgacccgcttcgcccaagacttggagtgggacagcctc actgtgctcgatttcgtcgccactatcgaggatgagttcgacgtcctcatcagcatgaac atgcaggccgagatcgagaatgtcggccagctcgtcgacgcggtggaaaagctcaaggcc gcgtga

DBGET integrated database retrieval system