Sardina pilchardus (sardine): 134070340 Help Entry 134070340         CDS       T10667                                  Symbol dnal4a Name (RefSeq) dynein, axonemal, light chain 4a   KO K10412   dynein axonemal light chain 4 Organism spil  Sardina pilchardus (sardine) Pathway spil04814   Motor proteins Brite KEGG Orthology (KO) [BR:spil00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     134070340 (dnal4a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:spil03037]     134070340 (dnal4a)    04812 Cytoskeleton proteins [BR:spil04812]     134070340 (dnal4a) Cilium and associated proteins [BR:spil03037]  Motile cilia and associated proteins   Dynein arm    134070340 (dnal4a) Cytoskeleton proteins [BR:spil04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      134070340 (dnal4a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  134070340 NCBI-ProteinID:  XP_062382641 LinkDB All DBs Position 22:3965303..3971861 Genome browser AA seq 106 aa AA seqDB search MAETGDSKKEEADYKRLHSFPLIRHTDMPEEMRVETMELCVTACEKFATNNESAAKMIKE TMDKKFGSSWHVVIGEGFGFEVTHEVKNLLYMFFGGSLAVCVWKCS NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggcagagacaggtgatagtaaaaaggaagaagctgactacaagagactacacagtttc cctctcataaggcacacagatatgccggaggagatgagagttgagaccatggagctgtgt gtcactgcctgcgagaagtttgccaccaacaacgagagcgcggccaagatgatcaaggag accatggacaagaagttcggcagctcgtggcacgtggtgatcggcgagggcttcggcttc gaggtcacgcacgaggtcaagaacctgctctacatgttcttcggagggagcctggccgtg tgtgtgtggaagtgctcctag

DBGET integrated database retrieval system