Sardina pilchardus (sardine): 134070721 Help Entry 134070721         CDS       T10667                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism spil  Sardina pilchardus (sardine) Pathway spil04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:spil00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     134070721  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:spil04121]     134070721    03400 DNA repair and recombination proteins [BR:spil03400]     134070721 Ubiquitin system [BR:spil04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      134070721    Cul5 complex      134070721 DNA repair and recombination proteins [BR:spil03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      134070721 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  134070721 NCBI-ProteinID:  XP_062383136 LinkDB All DBs Position 22:6753372..6758043 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRAPEDQRLFKDEQLLDDSKTLGDY GYTNQTARPQAPATVGLAFRLTGDTFEPLQVEPFSSPPELPDVMKPQDSGSTANEQSVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtctttttaatgatccggcgtcacaagacgacaatcttcactgacgccaaggag tccactacggtatacgagctcaaacgcatcgtggagggtattcttaagagagctcccgaa gaccagagactcttcaaggatgagcagctcctggatgacagtaagactctgggtgactat ggctacacaaaccagaccgctcgcccccaggctcctgccaccgttggcctggccttccgt ctcactggtgacacctttgagccgctgcaggtggagccgttctccagccctccagagttg cccgatgtgatgaagccccaggactccggcagcaccgccaacgagcagtccgttcagtga

DBGET integrated database retrieval system