Sardina pilchardus (sardine): 134072765 Help Entry 134072765         CDS       T10667                                  Symbol mbpa Name (RefSeq) myelin basic protein isoform X1   KO K17269   myelin basic protein Organism spil  Sardina pilchardus (sardine) Pathway spil04517   IgSF CAM signaling Brite KEGG Orthology (KO) [BR:spil00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     134072765 (mbpa)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:spil03019]     134072765 (mbpa)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:spil04147]     134072765 (mbpa) Messenger RNA biogenesis [BR:spil03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      134072765 (mbpa) Exosome [BR:spil04147]  Exosomal proteins   Exosomal proteins of oligodendrocytes    134072765 (mbpa) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Myelin_MBP Motif Other DBs NCBI-GeneID:  134072765 NCBI-ProteinID:  XP_062385587 LinkDB All DBs Position 24:18041864..18050744 Genome browser AA seq 89 aa AA seqDB search MATASTSGQSAFGLGRKKKAPGLLDQIGKFFGIDKKKRGKRPQHSSSRRRADENVVVHFF RSFVSSSPRPRSRGESRSRSPPKRWSTIF NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggccactgcaagcacctcaggtcagagtgcctttggactgggcaggaaaaagaaggct cccgggctcctggaccagattggcaaattctttggaatagacaagaagaaaagaggcaag aggccacagcactcctcatctcgtcgtcgtgcagatgaaaatgtggtggtacacttcttc aggagctttgtgtcttcatccccccgtccaaggtcaaggggagagagccgatcccgctcc ccccctaaacgctggagcaccatcttctga

DBGET integrated database retrieval system