Sardina pilchardus (sardine): 134079797 Help Entry 134079797         CDS       T10667                                  Name (RefSeq) insulin-like   KO K04526   insulin Organism spil  Sardina pilchardus (sardine) Pathway spil04010   MAPK signaling pathway spil04068   FoxO signaling pathway spil04081   Hormone signaling spil04114   Oocyte meiosis spil04140   Autophagy - animal spil04150   mTOR signaling pathway spil04810   Regulation of actin cytoskeleton spil04910   Insulin signaling pathway spil04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:spil00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     134079797    04068 FoxO signaling pathway     134079797    04150 mTOR signaling pathway     134079797   09133 Signaling molecules and interaction    04081 Hormone signaling     134079797  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     134079797   09143 Cell growth and death    04114 Oocyte meiosis     134079797   09142 Cell motility    04810 Regulation of actin cytoskeleton     134079797  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     134079797    04914 Progesterone-mediated oocyte maturation     134079797  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:spil04052]     134079797 Cytokines and neuropeptides [BR:spil04052]  Neuropeptides   Unclassified    134079797 SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  134079797 NCBI-ProteinID:  XP_062391861 LinkDB All DBs Position 5:complement(14002588..14003634) Genome browser AA seq 110 aa AA seqDB search MALWLQTAALLVVVALSTTSTDAVTAQHLCGSHLVDALYLVCADEGFVFNPKRAVDPLQG FLPPKSGQENEVGETIVSRRGVMGDGIVQQCCHKPCSIFELQKYCSSFHN NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggctctctggctccaaacagctgctctgcttgtggtggtggctctgtcgaccacaagc accgatgccgtcaccgcccaacacctgtgcgggtcgcacctggtggacgcactctacctg gtgtgcgcagatgagggcttcgtcttcaatcctaagagagctgtggaccccctacagggg ttcctgcctccaaaatctggccaggagaacgaggtgggagagaccatcgtctcgaggagg ggggttatgggagatggaattgtgcagcagtgctgccacaagccctgcagcatcttcgag cttcaaaagtactgtagctcgttccacaactga

DBGET integrated database retrieval system