Sardina pilchardus (sardine): 134087752 Help Entry 134087752         CDS       T10667                                  Symbol nras Name (RefSeq) GTPase NRas isoform X1   KO K07828   GTPase NRas Organism spil  Sardina pilchardus (sardine) Pathway spil04010   MAPK signaling pathway spil04012   ErbB signaling pathway spil04068   FoxO signaling pathway spil04137   Mitophagy - animal spil04140   Autophagy - animal spil04150   mTOR signaling pathway spil04210   Apoptosis spil04218   Cellular senescence spil04370   VEGF signaling pathway spil04371   Apelin signaling pathway spil04540   Gap junction spil04625   C-type lectin receptor signaling pathway spil04810   Regulation of actin cytoskeleton spil04910   Insulin signaling pathway spil04912   GnRH signaling pathway spil04916   Melanogenesis Brite KEGG Orthology (KO) [BR:spil00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     134087752 (nras)    04012 ErbB signaling pathway     134087752 (nras)    04370 VEGF signaling pathway     134087752 (nras)    04371 Apelin signaling pathway     134087752 (nras)    04068 FoxO signaling pathway     134087752 (nras)    04150 mTOR signaling pathway     134087752 (nras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     134087752 (nras)    04137 Mitophagy - animal     134087752 (nras)   09143 Cell growth and death    04210 Apoptosis     134087752 (nras)    04218 Cellular senescence     134087752 (nras)   09144 Cellular community - eukaryotes    04540 Gap junction     134087752 (nras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     134087752 (nras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     134087752 (nras)   09152 Endocrine system    04910 Insulin signaling pathway     134087752 (nras)    04912 GnRH signaling pathway     134087752 (nras)    04916 Melanogenesis     134087752 (nras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:spil04131]     134087752 (nras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:spil04147]     134087752 (nras)    04031 GTP-binding proteins [BR:spil04031]     134087752 (nras) Membrane trafficking [BR:spil04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     134087752 (nras)  Endocytosis   Macropinocytosis    Ras GTPases     134087752 (nras) Exosome [BR:spil04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    134087752 (nras)   Exosomal proteins of other body fluids (saliva and urine)    134087752 (nras)   Exosomal proteins of breast cancer cells    134087752 (nras)   Exosomal proteins of colorectal cancer cells    134087752 (nras) GTP-binding proteins [BR:spil04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     134087752 (nras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  134087752 NCBI-ProteinID:  XP_062397440 LinkDB All DBs Position 7:complement(24959415..24965073) Genome browser AA seq 201 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADVHLYSEFCDPLPSPFFCREQIKRVKDSD DVPMVLVGNKCDLARTVDTKQAQELARSYGIEFVETSAKTRQGVEDAFYTLVREIRHYRM KKLNSREDRKQGCLGISCAVM NT seq 606 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaagttggtggtggttggtgcaggcggcgttggtaagagtgccctcacc atccagctcattcagaaccactttgtggatgaatacgatccgaccatcgaggattcgtac aggaagcaggtggtgatcgacggcgagacatgtctgctggacattctggacacagcagga caggaggagtatagcgccatgagggaccagtatatgaggacgggggaaggttttctctgc gtcttcgccatcaacaacagcaagtcttttgctgatgtgcatctgtacagtgaattctgt gaccctctcccatcccctttcttttgtagagaacagatcaagagggttaaggactctgat gatgtcccgatggtacttgtgggtaataaatgtgatctggctagaactgtagacacaaag caagcacaggagcttgccagaagttatggcatcgagtttgttgaaacctcagccaagaca agacagggagtggaggatgccttctacacactggttcgagaaatccgccactaccgcatg aagaagctcaacagcagagaggaccgcaaacagggatgtctgggcatctcctgtgctgtc atgtga

DBGET integrated database retrieval system