Sardina pilchardus (sardine): 134094127 Help Entry 134094127         CDS       T10667                                  Symbol hrasa Name (RefSeq) HRas proto-oncogene, GTPase a   KO K02833   GTPase HRas Organism spil  Sardina pilchardus (sardine) Pathway spil04010   MAPK signaling pathway spil04012   ErbB signaling pathway spil04068   FoxO signaling pathway spil04137   Mitophagy - animal spil04140   Autophagy - animal spil04144   Endocytosis spil04150   mTOR signaling pathway spil04210   Apoptosis spil04218   Cellular senescence spil04370   VEGF signaling pathway spil04371   Apelin signaling pathway spil04510   Focal adhesion spil04540   Gap junction spil04625   C-type lectin receptor signaling pathway spil04810   Regulation of actin cytoskeleton spil04910   Insulin signaling pathway spil04912   GnRH signaling pathway spil04916   Melanogenesis spil05132   Salmonella infection Brite KEGG Orthology (KO) [BR:spil00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     134094127 (hrasa)    04012 ErbB signaling pathway     134094127 (hrasa)    04370 VEGF signaling pathway     134094127 (hrasa)    04371 Apelin signaling pathway     134094127 (hrasa)    04068 FoxO signaling pathway     134094127 (hrasa)    04150 mTOR signaling pathway     134094127 (hrasa)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     134094127 (hrasa)    04140 Autophagy - animal     134094127 (hrasa)    04137 Mitophagy - animal     134094127 (hrasa)   09143 Cell growth and death    04210 Apoptosis     134094127 (hrasa)    04218 Cellular senescence     134094127 (hrasa)   09144 Cellular community - eukaryotes    04510 Focal adhesion     134094127 (hrasa)    04540 Gap junction     134094127 (hrasa)   09142 Cell motility    04810 Regulation of actin cytoskeleton     134094127 (hrasa)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     134094127 (hrasa)   09152 Endocrine system    04910 Insulin signaling pathway     134094127 (hrasa)    04912 GnRH signaling pathway     134094127 (hrasa)    04916 Melanogenesis     134094127 (hrasa)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     134094127 (hrasa)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:spil04131]     134094127 (hrasa)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:spil04147]     134094127 (hrasa)    04031 GTP-binding proteins [BR:spil04031]     134094127 (hrasa) Membrane trafficking [BR:spil04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     134094127 (hrasa)  Endocytosis   Macropinocytosis    Ras GTPases     134094127 (hrasa) Exosome [BR:spil04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    134094127 (hrasa)   Exosomal proteins of colorectal cancer cells    134094127 (hrasa) GTP-binding proteins [BR:spil04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     134094127 (hrasa) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin AAA_16 Motif Other DBs NCBI-GeneID:  134094127 NCBI-ProteinID:  XP_062403500 LinkDB All DBs Position 10:complement(29130272..29149749) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PSRTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CLNCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagagtacaagctggtggtggtgggagcaggtggcgttggcaagagtgcactcacc atccagctcatccagaaccactttgtggacgaatacgaccccaccatagaggactcgtac aggaaacaggtggtgatcgacggcgagacgtgtctgctggacatcttggacactgcaggt caggaggagtacagcgccatgagggaccagtacatgaggacaggggagggcttcctctgt gtctttgccatcaacaacaccaagtccttcgaagacattcaccagtacagggaacagatc aaacgagtgaaggactcggacgatgtgcccatggtgctcgtggggaataagtgtgacctg ccgtctcggacagtcgacacgcggcaggcccaggagctcgcccgcagctatggcatcccc tacatcgagacgtcggccaagacccgtcagggagtggaggacgccttctacacgctggtg cgtgagattcgacagcacaaattacgaaagctgaacccaccggacgagagtggacaggac tgcctgaactgccgctgtgtggtgtcttga

DBGET integrated database retrieval system