Sardina pilchardus (sardine): 134094612 Help Entry 134094612         CDS       T10667                                  Symbol kras Name (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism spil  Sardina pilchardus (sardine) Pathway spil04010   MAPK signaling pathway spil04012   ErbB signaling pathway spil04068   FoxO signaling pathway spil04137   Mitophagy - animal spil04140   Autophagy - animal spil04150   mTOR signaling pathway spil04210   Apoptosis spil04218   Cellular senescence spil04370   VEGF signaling pathway spil04371   Apelin signaling pathway spil04540   Gap junction spil04625   C-type lectin receptor signaling pathway spil04810   Regulation of actin cytoskeleton spil04910   Insulin signaling pathway spil04912   GnRH signaling pathway spil04914   Progesterone-mediated oocyte maturation spil04916   Melanogenesis Brite KEGG Orthology (KO) [BR:spil00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     134094612 (kras)    04012 ErbB signaling pathway     134094612 (kras)    04370 VEGF signaling pathway     134094612 (kras)    04371 Apelin signaling pathway     134094612 (kras)    04068 FoxO signaling pathway     134094612 (kras)    04150 mTOR signaling pathway     134094612 (kras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     134094612 (kras)    04137 Mitophagy - animal     134094612 (kras)   09143 Cell growth and death    04210 Apoptosis     134094612 (kras)    04218 Cellular senescence     134094612 (kras)   09144 Cellular community - eukaryotes    04540 Gap junction     134094612 (kras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     134094612 (kras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     134094612 (kras)   09152 Endocrine system    04910 Insulin signaling pathway     134094612 (kras)    04912 GnRH signaling pathway     134094612 (kras)    04914 Progesterone-mediated oocyte maturation     134094612 (kras)    04916 Melanogenesis     134094612 (kras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:spil04131]     134094612 (kras)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:spil04031]     134094612 (kras) Membrane trafficking [BR:spil04131]  Endocytosis   Macropinocytosis    Ras GTPases     134094612 (kras) GTP-binding proteins [BR:spil04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     134094612 (kras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin AAA_16 CbiA Motif Other DBs NCBI-GeneID:  134094612 NCBI-ProteinID:  XP_062404189 LinkDB All DBs Position 10:complement(9442924..9453176) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQHRLKKISKEEKTPRC IKLKKCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagagtacaagctggtggtggtgggagctggtggcgttggcaagagtgcgctcacc atccagctcatccagaaccactttgtggacgaatacgaccccaccatagaggactcctac aggaagcaggtggtgattgacggagagacgtgtctgttggacatcttggacactgcaggt caggaggagtacagcgccatgagagaccagtacatgaggacaggggagggcttcctctgt gtctttgccatcaacaacaccaagtccttcgaggacattcatcactatagggagcagatc aagagagtgaaggactcggaggacgttcccatggtcctggtgggaaacaagtgtgacctc ccgtcccgcactgtggacaccaaacaggcccaggatctggcccgcagttacgggatccca ttcatcgagacgtcagccaagacgagacagagagtggaggatgccttttacactttggta cgggagatcagacagcaccggctgaaaaagatcagcaaggaagaaaagactccacgctgc atcaagctaaaaaaatgtgttgtgatgtga

DBGET integrated database retrieval system