Sardina pilchardus (sardine): 134095449 Help Entry 134095449         CDS       T10667                                  Symbol rras2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism spil  Sardina pilchardus (sardine) Pathway spil04010   MAPK signaling pathway spil04137   Mitophagy - animal spil04140   Autophagy - animal spil04218   Cellular senescence spil04371   Apelin signaling pathway spil04519   Cadherin signaling spil04625   C-type lectin receptor signaling pathway spil04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:spil00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     134095449 (rras2)    04371 Apelin signaling pathway     134095449 (rras2)   09133 Signaling molecules and interaction    04519 Cadherin signaling     134095449 (rras2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     134095449 (rras2)    04137 Mitophagy - animal     134095449 (rras2)   09143 Cell growth and death    04218 Cellular senescence     134095449 (rras2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     134095449 (rras2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     134095449 (rras2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:spil04147]     134095449 (rras2)    04031 GTP-binding proteins [BR:spil04031]     134095449 (rras2) Exosome [BR:spil04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    134095449 (rras2)   Exosomal proteins of bladder cancer cells    134095449 (rras2) GTP-binding proteins [BR:spil04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     134095449 (rras2) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 SLFN-g3_helicase ATP_bind_1 RHG35-p190PhoGP_pG1 FeoB_N Motif Other DBs NCBI-GeneID:  134095449 NCBI-ProteinID:  XP_062404973 LinkDB All DBs Position 11:12428298..12466904 Genome browser AA seq 202 aa AA seqDB search MAGWKDGSVQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERPA RLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPM ILVGNKADLELQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQE CPPSPEPTRKEKDKSGCHCVIV NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atggctgggtggaaggacggctcggtgcaggagaagtatcggctggttgtggttggaggt ggtggtgtcgggaaatctgcacttactatccaattcattcagtcgtacttcgtcacagat tatgaccccacgattgaagactcgtacaccaaacagtgcgtgattgacgagaggccggct cgactggacatcctggacactgccggtcaggaggagtttggggccatgagggagcagtac atgaggacaggggaaggcttcctgctcgtcttctccgtcacagacagggggagctttgag gagatctacaagttccagcgacagatcctcagagtgaaggatcgggatgaatttcccatg atccttgtgggtaacaaggccgacttggaacttcagagacaggtgacccaggaggaaggt cagcagctggcccggcagctgaaggtgacgtacatggaggcctcggctaagatccgcatg aatgtagaccaagcgttccacgagctggtccgagtaataaggaagttccaggagcaggag tgcccgccgtcgccggagcccacgcgcaaggagaaggacaagagcggctgccactgtgtc atcgtctga

DBGET integrated database retrieval system