Skermania pinensis: KV203_04095
Help
Entry
KV203_04095 CDS
T07358
Symbol
rplR
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
spin
Skermania pinensis
Pathway
spin03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
spin00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
KV203_04095 (rplR)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
spin03011
]
KV203_04095 (rplR)
Ribosome [BR:
spin03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
KV203_04095 (rplR)
Bacteria
KV203_04095 (rplR)
Archaea
KV203_04095 (rplR)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
Lsr2
Motif
Other DBs
NCBI-ProteinID:
QXQ14595
UniProt:
A0ABX8SDT0
LinkDB
All DBs
Position
909887..910306
Genome browser
AA seq
139 aa
AA seq
DB search
MAEKSTRTENQKAKRIPLGTDASTARRRAKTRRHLRLRKKVSGTAQRPRLVVNRSARHIH
VQLIDDLAGHTLAAASTIEADLRGADGDKKSLSAKVGTRIAERAKAAGVDTVVFDHGGHG
YHGRIAALADAAREGGLKF
NT seq
420 nt
NT seq
+upstream
nt +downstream
nt
atggctgagaaatcgactcggaccgagaatcagaaggccaagcggattccgctgggcacc
gacgcctccaccgcccgccggcgcgccaagacgcgtcggcacctgcggctgcgcaagaag
gtgtccggcaccgcgcagcggccccgcctggtggtgaaccgctcggcgcggcacatccac
gtgcagctgatcgacgacctggccgggcacaccctggcggccgcctccacgatcgaggcc
gacctgcgcggcgcggacggcgacaagaagtcgctgagcgccaaggtgggcacccggatc
gccgagcgggccaaggccgccggggtggacaccgtggtgttcgaccacggcgggcacggc
tatcacggccgaatcgccgcgttggccgatgccgctcgcgaaggtgggctgaagttctga
DBGET
integrated database retrieval system