Spirosoma sp. SC4-14: WBJ53_17465 Help Entry WBJ53_17465       CDS       T11499                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spio  Spirosoma sp. SC4-14 Pathway spio01100   Metabolic pathways spio01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spio00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     WBJ53_17465    00074 Mycolic acid biosynthesis     WBJ53_17465   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     WBJ53_17465 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Ribosomal_L50 PP-binding_2 Motif Other DBs NCBI-ProteinID:  WXC12772 LinkDB All DBs Position 4260138..4260383 Genome browser AA seq 81 aa AA seqDB search MTLAEINNRLQEILNGMGISLTALTDQANFIRDLGLDSLDVTDLLIRVETTFGIRIPDED WFSLQTVGQLKNYLLAEVKFD NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgacactagcagagattaacaatcgtttacaggagatactcaatggtatgggtatcagc ctcacagccttaaccgatcaggcaaactttatccgtgatcttggcctcgattcgctggac gtcacggacctactaatacgggtagaaactacttttggtattcgaattcccgacgaggac tggttttctctgcaaacggtgggtcagctcaaaaattatttgctggcagaagtaaaattc gattga

DBGET integrated database retrieval system