Spirillospora sp. NBC_01491: OHA34_06575 Help Entry OHA34_06575       CDS       T09711                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism spiq  Spirillospora sp. NBC_01491 Pathway spiq00253   Tetracycline biosynthesis spiq01056   Biosynthesis of type II polyketide backbone spiq01100   Metabolic pathways spiq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spiq00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     OHA34_06575    00253 Tetracycline biosynthesis     OHA34_06575  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:spiq01004]     OHA34_06575    01008 Polyketide biosynthesis proteins [BR:spiq01008]     OHA34_06575 Lipid biosynthesis proteins [BR:spiq01004]  Polyketide synthase   Component type    OHA34_06575 Polyketide biosynthesis proteins [BR:spiq01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      OHA34_06575     Nonaketide PKS      OHA34_06575     Decaketide PKS      OHA34_06575 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 PP-binding_2 Motif Other DBs NCBI-ProteinID:  WUU91456 UniProt:  A0AAU5WIY0 LinkDB All DBs Position complement(1365164..1365418) Genome browser AA seq 84 aa AA seqDB search MALFTVNDVRRILRDCAGEPDSISLDSEIGAVTFDEMGYDSLARLELAARIQQEFLVAIP DEKVDELGTPDDVVGYVTPRIAAA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggcgctgtttacggtgaacgacgtccggcgcatcctccgggactgcgcgggcgagccg gactccatcagcctggactcggagatcggcgcggtgaccttcgacgagatgggctacgac tcgctggcccgtctggagctggcggcgcggatccagcaggagttcctggtggccatcccc gacgagaaggtcgacgaactgggcacgcccgatgacgtggtcggctatgtcactccgcgc atcgccgccgcgtga

DBGET integrated database retrieval system