Spirillospora sp. NBC_01491: OHA34_12195 Help Entry OHA34_12195       CDS       T09711                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spiq  Spirillospora sp. NBC_01491 Pathway spiq00998   Biosynthesis of various antibiotics spiq01100   Metabolic pathways spiq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spiq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     OHA34_12195    00074 Mycolic acid biosynthesis     OHA34_12195   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     OHA34_12195 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 PP-binding_2 ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  WUU92517 LinkDB All DBs Position 2585018..2585269 Genome browser AA seq 83 aa AA seqDB search MAEATEQQILDGLAEIIDEIVGIDKSEVTPEKNFIDDLDIDSLSMVEIAVAAQDKFDVEI PDDELRNLKTVKDVINFVQNLQA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggcagaagccaccgagcagcagattctcgacggtctcgcggagatcatcgatgagatc gtcgggatcgacaagtccgaggtcaccccggagaagaacttcatcgacgacctcgacatc gactcgctgtcgatggtggagatcgcggtggccgcccaggacaagttcgatgtcgagatc cccgacgacgagctgcgcaacctgaagacggtcaaggacgtcatcaacttcgtccagaac ctccaggcataa

DBGET integrated database retrieval system