Spirillospora sp. NBC_01491: OHA34_26660
Help
Entry
OHA34_26660 CDS
T09711
Name
(GenBank) response regulator transcription factor
KO
K02483
two-component system, OmpR family, response regulator
Organism
spiq
Spirillospora sp. NBC_01491
Brite
KEGG Orthology (KO) [BR:
spiq00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
spiq02022
]
OHA34_26660
Two-component system [BR:
spiq02022
]
OmpR family
Unclassified
OHA34_26660
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
Trans_reg_C
B12-binding
Motif
Other DBs
NCBI-ProteinID:
WUU88038
LinkDB
All DBs
Position
5707779..5708510
Genome browser
AA seq
243 aa
AA seq
DB search
MAERTVNGGGRVPEALLLVVEDEPNILELLAGSLRFSGFEVVTATNGADAVQAARRHRPD
LIVLDVMLPDIDGFDVARRLRSGGDHTPVLFLTARDAVQDRIKGLTIGGDDYVTKPFSLE
EVIARIRAVLRRFRGGAAEPPPRMVFADVELDEDSHEVWRGGRAVQLSPTEFKLLRYFMA
NAGRVLSKAQILDHVWNYDFRGDAGIVESYVSALRRKVDNTEPRLIHTLRGVGYVLREPQ
NTG
NT seq
732 nt
NT seq
+upstream
nt +downstream
nt
ttggctgagcgtacggtgaacggcgggggcagggtgcctgaggcgctgctcctcgtcgtc
gaggacgagcccaacatcctggagctgctcgccggcagcctccggttcagcggcttcgag
gtcgtgaccgcgaccaacggcgccgacgccgtgcaggcggcgcgccggcaccggcccgac
ctgatcgtcctggacgtgatgctgcccgacatcgacgggttcgacgtcgcgcggcggctc
cgctcgggcggcgaccacaccccggtgctgttcctcaccgcccgcgacgcggtgcaggac
cggatcaagggcctgaccatcggcggcgacgactacgtcaccaagccgttcagcctggag
gaggtcatcgcgcggatccgcgcggtgctgcggcggttccgcggcggcgcggccgagccc
ccgccgcggatggtcttcgccgacgtcgagctggacgaggacagccacgaggtgtggcgc
ggcggccgggccgtccagctctcgccgaccgagttcaagctcctgcgctacttcatggcg
aacgcgggccgggtgctgtccaaggcgcagatcctcgaccacgtgtggaactacgacttc
cgcggtgacgccggcatcgtcgagtcctacgtctcggcgctgcgccgcaaggtcgacaac
accgagccgcggctgatccacaccctgcgcggggtgggctacgtgctgcgcgagccgcag
aacaccggctga
DBGET
integrated database retrieval system