Spiribacter sp. 2438: GJ672_02660 Help Entry GJ672_02660       CDS       T06294                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism spiz  Spiribacter sp. 2438 Pathway spiz02024   Quorum sensing spiz03018   RNA degradation Brite KEGG Orthology (KO) [BR:spiz00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     GJ672_02660 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     GJ672_02660 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:spiz03019]     GJ672_02660 (hfq)    03036 Chromosome and associated proteins [BR:spiz03036]     GJ672_02660 (hfq) Messenger RNA biogenesis [BR:spiz03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      GJ672_02660 (hfq) Chromosome and associated proteins [BR:spiz03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     GJ672_02660 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Gag_p24_C Motif Other DBs NCBI-ProteinID:  QGM21281 LinkDB All DBs Position 527445..527696 Genome browser AA seq 83 aa AA seqDB search MSKGQSLQEPFLNALRKEKIPVSIYLVNGIKLQGQVESFDQFVILLRNSISQMVYKHAIS TIVPSRNVRTLLQEERNPEADDD NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaggggcaatcattgcaggagccgtttctcaacgcgctgcgaaaagaaaaaatt ccggtctccatttacctggtgaacgggatcaagctgcaggggcaggtggagtccttcgat cagttcgtgatcctgttgcgtaattccatcagtcagatggtgtacaagcacgccatctcg accattgtcccgtcacgtaacgtccgcacgttgttgcaggaggagcgcaatcccgaagcc gacgacgattga

DBGET integrated database retrieval system