Spiribacter sp. 2438: GJ672_03010 Help Entry GJ672_03010       CDS       T06294                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism spiz  Spiribacter sp. 2438 Brite KEGG Orthology (KO) [BR:spiz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:spiz03036]     GJ672_03010    03400 DNA repair and recombination proteins [BR:spiz03400]     GJ672_03010 Chromosome and associated proteins [BR:spiz03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     GJ672_03010 DNA repair and recombination proteins [BR:spiz03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       GJ672_03010 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS DUF1002 BCAS2 Cnd1_N Pilus_CpaD 60KD_IMP Motif Other DBs NCBI-ProteinID:  QGM22518 UniProt:  A0A6B8JRU7 LinkDB All DBs Position 590034..590345 Genome browser AA seq 103 aa AA seqDB search MDLSTYTTQQLNELKKDIDKEINSRRKEDAKKAQQEIKQVAERYGFNLTDLVAGQPARTR SKGKVRFQHPADASKTWSGRGRKPGWVKEWEASGRSVEELRVD NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggatctctccacttacacgacccagcagcttaacgagctcaagaaagatattgataaa gagattaatagccggcgcaaggaagatgcgaaaaaggcccagcaggaaatcaagcaggtt gccgagcgctacggctttaatctcacggatctggtggcagggcagccagcccgcacccgg tccaaggggaaagtccgtttccagcatcccgcagacgccagcaaaacctggtccgggcgc gggcgtaaacccggctgggtcaaggagtgggaggccagcggccgctcggtggaggagctt cgggtcgactga

DBGET integrated database retrieval system