KEGG   Spiribacter sp. 2438: GJ672_06695
Entry
GJ672_06695       CDS       T06294                                 
Symbol
clpS
Name
(GenBank) ATP-dependent Clp protease adapter ClpS
  KO
K06891  ATP-dependent Clp protease adaptor protein ClpS
Organism
spiz  Spiribacter sp. 2438
Brite
KEGG Orthology (KO) [BR:spiz00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    GJ672_06695 (clpS)
SSDB
Motif
Pfam: ClpS
Other DBs
NCBI-ProteinID: QGM21975
LinkDB
Position
complement(1350150..1350470)
AA seq 106 aa
MSEENDPNQDDGLSVEEAKPEVRQPRLYQVVLLNDDYTPMEFVVEVLQTFFRMDREQATQ
VMLHVHTRGKGVCGVFSRDIAETKVDQVNDYAREHHHPLMCTMEPA
NT seq 321 nt   +upstreamnt  +downstreamnt
atgagcgaagagaacgatccgaaccaagatgacggtctgtcggtcgaagaagccaagccg
gaagtcagacagccgcggctttaccaagtggttctgctcaatgatgactacaccccgatg
gaattcgtggtagaggtattacagacgttcttccgcatggatcgggagcaggccacacag
gtgatgctccacgtccacactcgagggaagggggtatgtggtgtcttcagccgcgacatt
gcggagaccaaagtcgaccaggtcaacgactacgcacgtgaacaccatcatccgctgatg
tgcacgatggaaccggcctga

DBGET integrated database retrieval system