Sphingopyxis sp. J-6: V6U71_04825 Help Entry V6U71_04825       CDS       T10764                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spjj  Sphingopyxis sp. J-6 Pathway spjj00998   Biosynthesis of various antibiotics spjj01100   Metabolic pathways spjj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spjj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     V6U71_04825    00074 Mycolic acid biosynthesis     V6U71_04825   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     V6U71_04825 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  XMG41387 LinkDB All DBs Position 979914..980150 Genome browser AA seq 78 aa AA seqDB search MSDSAEKVKKIVVEHLGVEADKVTEEASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKIATVKDAIDYIEANKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgattcggccgaaaaggttaagaagatcgtcgtcgaacatctgggcgtcgaagcc gacaaggtcaccgaagaagcgagcttcatcgacgatctgggcgccgacagcctcgacatc gttgaactggtgatggcgttcgaagaagaattcggcgtcgaaatccccgacgatgcggcg gaaaagatcgccaccgtcaaggatgcgatcgactatatcgaagcgaacaagggctaa

DBGET integrated database retrieval system