Sphingobium sp. JS3065: NUH86_00325 Help Entry NUH86_00325       CDS       T10812                                  Name (GenBank) ATP synthase F1 subunit epsilon   KO K02114   F-type H+-transporting ATPase subunit epsilon Organism spjs  Sphingobium sp. JS3065 Pathway spjs00190   Oxidative phosphorylation spjs01100   Metabolic pathways Module spjs_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:spjs00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     NUH86_00325  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:spjs00194]     NUH86_00325 Photosynthesis proteins [BR:spjs00194]  Photosystem and electron transport system   F-type ATPase [OT]    NUH86_00325 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_DE_N Motif Other DBs NCBI-ProteinID:  UZW55298 LinkDB All DBs Position 1:complement(73420..73674) Genome browser AA seq 84 aa AA seqDB search MALHFELVTPEKLVRSEEVYQVVVPGTDGDFGVLEGHAPFMSTVRDGALQIFASAGAAPE VIPVRGGFAEVNEKGLTVLAEHAG NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggcactgcatttcgaactcgtgaccccggaaaagctcgtccgctcggaagaggtctat caggtggtcgtccccggcaccgatggcgacttcggcgtgctggagggccacgcgcccttc atgtccaccgtccgcgacggcgcgttgcagatcttcgccagcgcgggcgcggcgccggaa gtcatcccggtccgcggcggctttgccgaggtcaatgaaaagggcctgaccgtccttgcg gagcatgctggctga

DBGET integrated database retrieval system