Sphingobium sp. JS3065: NUH86_01105 Help Entry NUH86_01105       CDS       T10812                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spjs  Sphingobium sp. JS3065 Pathway spjs00998   Biosynthesis of various antibiotics spjs01100   Metabolic pathways spjs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spjs00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NUH86_01105    00074 Mycolic acid biosynthesis     NUH86_01105   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NUH86_01105 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N DUF1493 Ribosomal_L50 DUF5783 Motif Other DBs NCBI-ProteinID:  UZW55431 LinkDB All DBs Position 1:214647..214880 Genome browser AA seq 77 aa AA seqDB search MSETADRVKKIVVEHLGVEAEKVTEDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKIATVKDAIDYIDSKQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtgagaccgcggatcgcgtaaagaaaatcgtcgtcgagcatctgggcgtcgaagcc gagaaggtgaccgaggatgcgagcttcattgacgatctgggcgctgacagcctggacatc gtcgagctggtgatggcgttcgaggaagaattcggcgtcgaaatccccgacgatgcggcg gaaaagatcgccaccgtcaaggacgccatcgattatatcgacagcaagcagtaa

DBGET integrated database retrieval system