Sphingobium sp. JS3065: NUH86_10465
Help
Entry
NUH86_10465 CDS
T10812
Symbol
tatC
Name
(GenBank) twin-arginine translocase subunit TatC
KO
K03118
sec-independent protein translocase protein TatC
Organism
spjs Sphingobium sp. JS3065
Pathway
spjs03060
Protein export
spjs03070
Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:
spjs00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03060 Protein export
NUH86_10465 (tatC)
09130 Environmental Information Processing
09131 Membrane transport
03070 Bacterial secretion system
NUH86_10465 (tatC)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02044 Secretion system [BR:
spjs02044
]
NUH86_10465 (tatC)
Secretion system [BR:
spjs02044
]
Twin-arginine translocation (Tat) system
Twin-arginine translocation (Tat) pathway protein
NUH86_10465 (tatC)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
TatC
DUF7534
Motif
Other DBs
NCBI-ProteinID:
UZW53964
LinkDB
All DBs
Position
1:complement(2189814..2190590)
Genome browser
AA seq
258 aa
AA seq
DB search
MKDLDDSKAPLLDHLIELRGRLLKCVYALFITGAVCFYFSEQLFAILVYPLKEAFGDGGG
RLVYTKLYEAFFVQVKIAVFGAFCLSFPIIANQLWAFVAPGLYAKEKKALLPFILATPFL
FAMGASLAYFVVMPTAFHFFLEFQGNSSGLQVEALPSADAYLGLVMQFILAFGISFLMPV
LLMLLNRAGFVSRAQLIALRRYMIVAAFILAAVLTPPDVVSQLMLAIPLLALYEVTIIAI
WFTDRKQARQLGASEAAG
NT seq
777 nt
NT seq
+upstream
nt +downstream
nt
atgaaggatcttgacgacagcaaggcgcccctgctcgaccatctgatcgaactgcgcggt
cggctgctcaaatgcgtctatgcgctgttcatcacgggcgcggtctgcttctatttttcg
gagcagttgttcgccatattggtctatccgctcaaggaagcttttggcgacggcggcggg
cggttggtctacaccaagctttacgaagcctttttcgtgcaggtgaagatcgcggttttc
ggcgctttctgcctatcctttccgatcattgccaaccagctatgggctttcgtcgcgccg
gggctgtacgcgaaggagaagaaggcgttgttgcccttcatcctcgccacgccctttctc
ttcgccatgggcgcgagcctcgcttatttcgtggtgatgccgaccgccttccacttcttc
ctggaatttcaggggaacagcagcggattgcaggtcgaggcgttgcccagcgcggacgct
tatctggggctggtgatgcagttcatactggccttcggcatcagcttcctgatgccggtg
ctgctgatgctgctcaatcgcgccggattcgtcagccgggcgcaattgatcgccctgcgc
cgctatatgatcgtcgcggcattcatcctggcggcggtgctgacgccgccggacgtggtt
tcgcaactgatgctcgccatccctctgctggcgctttacgaggtcacgatcatcgcgatc
tggttcaccgaccggaagcaagccaggcaattgggggcttccgaagcggcaggctga
DBGET
integrated database retrieval system