Sphingomonas sp. KC8: KC8_00635 Help Entry KC8_00635         CDS       T04987                                  Name (GenBank) glutaredoxin   KO K03676   glutaredoxin 3 Organism spkc  Sphingomonas sp. KC8 Brite KEGG Orthology (KO) [BR:spkc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:spkc03110]     KC8_00635 Chaperones and folding catalysts [BR:spkc03110]  Protein folding catalysts   Protein disulfide isomerase    KC8_00635 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like SH3BGR DSBA Thioredoxin_4 CLIC-like_N Motif Other DBs NCBI-ProteinID:  ARS25801 UniProt:  A0A1X9YAF8 LinkDB All DBs Position 122525..122782 Genome browser AA seq 85 aa AA seqDB search MPKVEIYTKFLCPYCTRAKKLLGDKGVTFEEYDITMGGPKRAEMLDRAKGGSTVPQIFIN DQHVGGSDDLAALERAGKLDALLAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcccaaggtcgaaatctacaccaagttcctctgcccatattgcacccgcgccaagaag ctgctgggcgacaagggtgtcacgttcgaggaatatgacatcacgatgggcggccccaag cgcgccgagatgctcgatcgcgccaagggcggcagcaccgttccccagattttcatcaac gaccagcatgtcggcggatcggacgatctggccgcgctggaacgcgcgggcaagctggac gcgctgctcgccgcctga

DBGET integrated database retrieval system