Sphingomonas sp. KC8: KC8_03410 Help Entry KC8_03410         CDS       T04987                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spkc  Sphingomonas sp. KC8 Pathway spkc01100   Metabolic pathways spkc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spkc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KC8_03410    00074 Mycolic acid biosynthesis     KC8_03410   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KC8_03410 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ARS26339 UniProt:  A0A1X9YC29 LinkDB All DBs Position complement(723554..723790) Genome browser AA seq 78 aa AA seqDB search MSETAERVKKIVVEHLGVEADKVNEEASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKIATVKDAISYIDANKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgagaccgccgagcgcgtgaagaagatcgttgtcgaacacctcggcgtcgaagcc gacaaggtgaacgaagaagcgagcttcatcgatgatctgggcgcggacagcctcgacatc gtcgaactggtgatggcgttcgaagaagagttcggcgtggaaatccctgacgacgcggct gaaaagatcgccaccgtcaaggatgcgatcagctatatcgacgccaataagggctaa

DBGET integrated database retrieval system