Sphingomonas sp. KC8: KC8_09050 Help Entry KC8_09050         CDS       T04987                                  Name (GenBank) twin arginine translocase A   KO K03116   sec-independent protein translocase protein TatA Organism spkc  Sphingomonas sp. KC8 Pathway spkc03060   Protein export spkc03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:spkc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     KC8_09050  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     KC8_09050  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:spkc02044]     KC8_09050 Secretion system [BR:spkc02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    KC8_09050 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  ARS27437 UniProt:  A0A1X9YF56 LinkDB All DBs Position complement(1896186..1896437) Genome browser AA seq 83 aa AA seqDB search MGGLSIWHWLVVGVIVLLLFGKGRFSDMMGDVAKGIKSFKKGMAEDDEAAKPAAPAPRLQ AQQPIEPNPDRNLQPMQDDRPAQ NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgggtggcctcagtatctggcattggctcgtcgtcggggtcatcgtgctcctgctgttc ggcaaggggcgcttttccgacatgatgggcgacgttgccaagggcatcaaaagcttcaag aagggcatggccgaggacgatgaagcggcgaagcccgccgcgcccgcgccgcgcctgcag gcacagcagccgatcgaaccgaaccccgatcgcaaccttcagccgatgcaggatgaccgg ccggcccaataa

DBGET integrated database retrieval system