KEGG   Sphingomonas sp. KC8: KC8_18755
Entry
KC8_18755         CDS       T04987                                 
Name
(GenBank) chromosome segregation protein SMC
  KO
K03529  chromosome segregation protein
Organism
spkc  Sphingomonas sp. KC8
Brite
KEGG Orthology (KO) [BR:spkc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spkc03036]
    KC8_18755
Chromosome and associated proteins [BR:spkc03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Condensin-like complex
    KC8_18755
SSDB
Motif
Pfam: SMC_N AAA_23 AAA_21 AAA_15 ABC_tran AAA_29
Other DBs
NCBI-ProteinID: ARS29314
LinkDB
Position
3861085..3864510
AA seq 1141 aa
MRIRRLKLSGFKSFVEPSELRIEPGLTGVVGPNGCGKSNLLEAIRWVMGESSAKSMRGGG
MEDVIFAGTTTRPARDFAEVSILVDRAATGDGQDGEIEVVRRIERGAGSAYRLNGRDVRA
KDVGLLFADAATGAHSPALVSQGRIAAVIAAKPAERRQMLEEAAGIAGLHVRRKDAEQKL
RATEANLTRLDELLSDMEVRGGALRRQARAAERYRQLSEQIRLAEAKLIFARWREAATAA
DAARHEADAAAAFAAACAEAQRAAAAHQADAVRAVGDARAAAQTTRDAAAAAGHALAGLR
TERSALERRIAELATQAETLARDRAREDTLAVDAAAALARLAEEDKALVAARTRAEAEQI
AIASRLSDAENLARDAEVAMAHAVADEAAEQAELRVAQAALAAARQRLQRADAELARAVA
EAAQLPSAEPLVTQQKAAIAAGDAAQIAGRQAGAAIAAAEASRDEAAAARDGAESRAAAA
RAALAALESEAAALARALDTGGGQGRALDSVSALPGFERALAAALGDELDAVIGPTGKRR
WVGAVADAADPVLPAGGEPLASRVTAPPELIRRLVQIAVVDADDGSIRLAVGQRLVTRDG
RMRRWDGFVAEDVGAAAAERLVRINRLAALQQALPPARDAVAATAADMAAAQADLVQAKA
LMEAARVRLADAETASRRAARDADMAAGALERLAGQRDQVEQRVARARAERDEASQGVDA
ADAIFTALPDGEAARGKVDQLRRTSDAARNALADVRAGAAALRQRADADARRLETVRGEI
KSWRSRAGDAARRIDEMGKRADAVAREAASLADAPDRLDSRIAALEGEVATVEAAATTAR
EAERLSDERLRQAEKAAADAGEALSLAREARAGAAARHENQEMRRIEMGRISGERFGCPA
PVLPEKLAFVGADVGDAAVQSALLDRLTADRERLGPVNLVADTELAELELSRATGQAERD
ELGEAINRLRGSIGSLNREGRMRLLAAFEAVDQHFRRLFTTLFAGGEAHLALTDSDDPLE
AGLEIMAQPPGKKLAALTLLSGGEQALTAVALIFALFLTNPAPICVLDEVDAPLDDANIE
RFCDLLDRMTRETETRYLIVTHNAVTMARMHRLFGVTMVERGVSRLVSVDLGGAERLLAA
E
NT seq 3426 nt   +upstreamnt  +downstreamnt
atgcgaatccgccgcctcaagctttcgggcttcaaaagtttcgtcgaaccttccgaactg
cggattgaaccggggttgaccggtgtcgtcggcccgaatggctgcggcaaatccaatctt
ctggaagcgatccgctgggtcatgggcgaaagctccgccaagtcgatgcgtggcgggggg
atggaagatgtcatcttcgccggtacgacgacacgcccggcgcgcgatttcgccgaagtt
tccatccttgtcgatcgcgcggcgacaggcgacgggcaggacggtgaaatcgaagtcgtc
cggcgcatcgagcgcggggccggttccgcctaccgcttgaacggccgtgacgttcgggcc
aaggatgtcggattgctctttgccgatgcggcgacgggcgcgcattcgccggcgttggtc
agccaaggccggatcgcagcggtcatcgccgccaaaccggcggaacgccggcagatgctg
gaagaagcggccggcatcgccggacttcacgtccggcgcaaggatgccgagcagaaattg
cgcgcgaccgaggcgaacctgactcgtcttgatgagttgctatccgatatggaagtgcgg
ggcggcgcgctgcggcggcaggcgcgggcggcggaacgctatcgccagctttctgaacag
atccgcctcgccgaagccaaattgatcttcgcccgctggcgtgaggccgcgaccgccgcg
gatgccgcaaggcacgaagcggacgccgccgccgcatttgccgcggcctgtgccgaggcg
cagcgcgccgcagcggcccatcaggctgatgcggtgcgcgcggtgggcgacgcgcgcgcg
gccgcgcagaccacccgtgacgccgccgccgccgccggacatgcgctggctggcctgcga
acggagcgtagcgcgctggagcgacggatagctgaactggccacgcaggcggaaacactg
gcgcgagaccgggcgcgggaagatacgctggcggtcgacgcggcggcggcgctggcccgt
ctggccgaggaggacaaagcgcttgtcgccgcgcggaccagggcagaggcggagcagatc
gcgatcgcatcgcgcctttccgacgcggaaaacctggcccgtgatgctgaagtggcgatg
gcccatgcggtggccgacgaggcggcggagcaggctgaattacgggtggcgcaggcggcg
ctggctgcggcacggcagcggctgcagcgggcggatgcggaactggcccgtgctgtggcg
gaggcggcacaattgccctctgccgaaccgctggtgacgcagcaaaaggccgcgattgct
gcaggcgacgccgcgcagatcgccgggaggcaagcaggtgcagcgatcgcggcagcggag
gcaagccgcgatgaagccgccgccgcccgtgacggggccgaatcgcgcgcggcggcggcc
cgcgcggcgctggccgcgctggaaagcgaggctgcggcgctggcccgcgcgctcgatacg
ggcggggggcagggcagggcgctggatagcgtcagcgcgcttcccggcttcgaacgcgcc
ctggcagcggcgctgggcgatgaactggatgccgtgatcggtccaacgggcaagcgccga
tgggtgggcgcggtcgcggatgcggccgatccggttctgccggccgggggcgagccactt
gcgtcgcgggtcacggctccacctgaactgatccgccggctggtgcagattgccgtggtt
gatgcggatgatggttcgatccggctggctgtcgggcaacgtctggtcacccgggacggg
cggatgcggcggtgggatgggtttgttgccgaagatgtcggcgctgccgccgctgaacgg
ctggtacggatcaaccggctggcggctttgcagcaggcgctgccgcccgcgcgcgatgcg
gtggcggcaacagccgccgatatggcggcagcccaggcggatctcgtgcaggccaaggcc
ctgatggaggccgcccgcgtgcgtctggccgatgcggagacggcctcgcgccgggccgcg
cgggatgccgatatggcggcaggcgcgttggagcgactggctggacagcgcgaccaggtc
gaacagcgcgttgcccgcgcgcgcgcggaacgcgatgaggcgagccagggcgttgatgcg
gcggatgccatatttaccgcgctgcccgatggagaagcggcgcgcggcaaggtcgaccag
ttgcgtcggacgagcgatgcggcacgcaatgcgctggcggatgtgcgcgctggcgcagcc
gcgttgcgacaaagggcggatgccgatgcccggcgactggaaaccgtgcgcggggaaatc
aaaagctggcgttcgcgcgcgggcgatgccgcgcgccggattgacgagatgggtaagcgc
gctgacgcggtggcgcgggaggcggcatcgcttgcggatgcgccagatcggctggacagc
cggattgccgcgctggagggcgaggtggcgaccgtcgaggctgcggccacgaccgcgcgt
gaggccgagcgactgtccgacgaacggttgcggcaggcggagaaggctgcggccgatgct
ggcgaggcgctcagccttgcgcgtgaggcgcgcgcaggggctgctgcccggcatgagaat
caggaaatgcgccgcatcgaaatggggcgcatttcgggcgagcgtttcggttgtccggcg
ccggtgctgccggagaaactggcctttgtcggtgcggatgtcggcgatgcggccgtccaa
tccgcgctgctcgatcggctgacggcggatcgcgagcggctcggcccggtcaatctggtc
gccgataccgaactggccgaactcgaattgtcgcgtgcgaccgggcaggcggaacgcgat
gaactgggagaggcgatcaaccggctgcgcggatcgatcggcagtctgaaccgcgaaggg
cggatgcggctgctcgcggcatttgaagcggtcgaccagcatttccgccgccttttcacg
acgctgttcgccggcggcgaggcccatctcgcgctcaccgattcggatgatccgttggag
gcggggctggaaatcatggcccagccgccgggcaagaaactggccgcgcttaccctgttg
tccggcggtgaacaggcgctgacggcggtggcgctgatatttgccttgttcctgacaaat
ccggcgccgatctgcgtgcttgatgaagtggatgccccgcttgatgatgcgaatatcgaa
cgcttctgtgatctgctggatcgcatgacccgggaaacggaaacgcgttatctgatcgtg
acccataatgcggtcacgatggcgcggatgcatcgcttgttcggcgtgacgatggtggaa
cggggcgtcagccggctggtatcggtcgatctgggcggggcggaacggctgctcgcggct
gaatga

DBGET integrated database retrieval system