Shewanella pealeana: Spea_0077 Help Entry Spea_0077         CDS       T00606                                  Name (GenBank) conserved hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism spl  Shewanella pealeana Pathway spl02020   Two-component system spl02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:spl00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Spea_0077  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     Spea_0077  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:spl02035]     Spea_0077 Bacterial motility proteins [BR:spl02035]  Flagellar system   Flagellar assembly proteins    Others     Spea_0077 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Phlebo_G2_C Motif Other DBs NCBI-ProteinID:  ABV85406 UniProt:  A8GYL9 LinkDB All DBs Position 88187..88471 Genome browser AA seq 94 aa AA seqDB search MEINKVNSTVNTEMGTNRSKTFSLVQPQEPQAVVKKPQAEVSDDCKLIAHNQPQLEQLAD VDLDKVAQIRQSLIDGSFEIDIDKMVDAMVQQHG NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggagattaataaagtaaacagtacggtaaatactgaaatgggtaccaatcggagtaaa accttcagtttggtccagcctcaggagcctcaagctgttgttaaaaagccccaagctgag gttagcgatgattgtaaactcattgcgcataaccagccgcagcttgagcagttagccgat gtcgacctagataaggttgcgcagatccgtcaatcactgattgatggtagctttgagatt gatatcgacaagatggtcgatgccatggtgcagcagcatggttaa

DBGET integrated database retrieval system