Shewanella pealeana: Spea_1336 Help Entry Spea_1336         CDS       T00606                                  Name (GenBank) anti-sigma-28 factor, FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism spl  Shewanella pealeana Pathway spl02020   Two-component system spl02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:spl00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Spea_1336  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     Spea_1336  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:spl02035]     Spea_1336 Bacterial motility proteins [BR:spl02035]  Flagellar system   Flagellar assembly proteins    Others     Spea_1336 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  ABV86663 UniProt:  A8H276 LinkDB All DBs Position complement(1631078..1631395) Genome browser AA seq 105 aa AA seqDB search MAIDIKQVNTHANTRIGMGMNAKGAPAQTAPSAPAQSAQKTDSVSITAQAQQIQNVQTKM ADMPEIDQKKVDAIKAAIAEGRYKIDPEKLATNIASFENDLKDLS NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggctattgatattaaacaagtaaatacccatgccaatactcgtattggcatgggtatg aatgcgaaaggtgcaccggctcaaaccgcaccgtcggcgccggctcaaagcgcacagaaa actgattcagtgtcgattacggcgcaggctcagcaaatccaaaacgtacagactaagatg gctgacatgcctgaaatcgatcaaaagaaagtagatgcaatcaaagcggcaatagctgaa ggtcgttataaaatcgatcctgaaaaactggcaactaacatcgctagctttgagaatgat cttaaagatttaagttaa

DBGET integrated database retrieval system